Rbpj Rabbit Polyclonal Antibody TA339863 from OriGene Technologies | Biocompare.com

Supplier Images

Rbpj Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: Rbpj; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rbpj Rabbit Polyclonal Antibody

The Rbpj Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RBPJ. This antibody recognizes Mouse antigen. The Rbpj Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Rbpj Antibody

Product Specs
ItemRbpj Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339863
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetRbpj
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Rbpj antibody is: synthetic peptide directed towards the middle region of Mouse Rbpj. Synthetic peptide located within the following region: MGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAET
NCBI Full Gene Namerecombination signal binding protein for immunoglobulin kappa J region
NCBI Gene AliasesCBF1, Igkjrb, RBPjk, RBP-J kappa, RBP-J, RBP-Jkappa, Rbpsuh, Igkrsbp
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!