KCNQ4 Rabbit Polyclonal Antibody TA338541 from OriGene Technologies | Biocompare.com

Supplier Images

KCNQ4 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNQ4 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate
KCNQ4 Rabbit Polyclonal Antibody

Lanes: ; 100 ug CHO cell lysate; Primary Antibody Dilution: ; 1:1000; Secondary Antibody: ; Goat anti-rabbit HRP; Secondary Antibody Dilution: ; 1:25000; Gene Name: ; KCNQ4; Submitted by: ; Anonymous;

Be the first to write a review!

Supplier Page from
OriGene Technologies for
KCNQ4 Rabbit Polyclonal Antibody

OriGene Technologies' KCNQ4 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-KCNQ4 Antibody

Product Specs
ItemKCNQ4 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338541
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Hamster
TargetKCNQ4
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-KCNQ4 antibody: synthetic peptide directed towards the middle region of human KCNQ4. Synthetic peptide located within the following region: SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ
NCBI Full Gene Namepotassium voltage-gated channel subfamily Q member 4
NCBI Gene AliasesDFNA2, DFNA2A, KV7.4
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!