SMYD3 Rabbit Polyclonal Antibody TA339750 from OriGene Technologies | Biocompare.com

Supplier Images

SMYD3 Rabbit Polyclonal Antibody

WB Suggested Anti-SMYD3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Stomach
SMYD3 Rabbit Polyclonal Antibody

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Be the first to write a review!

Supplier Page from
OriGene Technologies for
SMYD3 Rabbit Polyclonal Antibody

OriGene Technologies' SMYD3 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Precipitation, ChIP, Immunoprecipitation, and Western Blot.

Description

Rabbit Polyclonal Anti-SMYD3 Antibody

Product Specs
ItemSMYD3 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339750
Quantity100 µl
Applications10k-ChIP, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetSMYD3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-SMYD3 antibody: synthetic peptide directed towards the N terminal of human SMYD3. Synthetic peptide located within the following region: PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL
NCBI Full Gene NameSET and MYND domain containing 3
NCBI Gene AliasesKMT3E, ZNFN3A1, bA74P14.1, ZMYND1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!