C1orf55 (SDE2) Rabbit Polyclonal Antibody TA338885 from OriGene Technologies | Biocompare.com

Supplier Images

C1orf55 (SDE2) Rabbit Polyclonal Antibody

WB Suggested Anti-SDE2 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C1orf55 (SDE2) Rabbit Polyclonal Antibody

OriGene Technologies' C1orf55 (SDE2) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-SDE2 Antibody

Product Specs
ItemC1orf55 (SDE2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338885
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetC1orf55
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C1orf55 antibody: synthetic peptide directed towards the C terminal of human C1orf55. Synthetic peptide located within the following region: AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID
NCBI Full Gene NameSDE2 telomere maintenance homolog
NCBI Gene AliasesdJ671D7.1, C1orf55
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!