KCNH6 Rabbit Polyclonal Antibody TA338714 from OriGene Technologies | Biocompare.com

Supplier Images

KCNH6 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNH6 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate
KCNH6 Rabbit Polyclonal Antibody

Human Brain

Be the first to write a review!

Supplier Page from
OriGene Technologies for
KCNH6 Rabbit Polyclonal Antibody

OriGene Technologies' KCNH6 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-KCNH6 Antibody

Product Specs
ItemKCNH6 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA338714
Quantity100 µl
ApplicationsIHC, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetKCNH6
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the N terminal of human KCNH6. Synthetic peptide located within the following region: GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK
NCBI Full Gene Namepotassium voltage-gated channel subfamily H member 6
NCBI Gene AliasesERG-2, hERG-2, HERG2, ERG2, Kv11.2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!