ARID5A Rabbit Polyclonal Antibody TA339849 from OriGene Technologies | Biocompare.com

Supplier Images

ARID5A Rabbit Polyclonal Antibody

WB Suggested Anti-ARID5A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysate ARID5A is supported by BioGPS gene expression data to be expressed in 721_B
ARID5A Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: ARID5A; Sample Tissue: 721_B; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration: 0

Be the first to write a review!

Supplier Page from
OriGene Technologies for
ARID5A Rabbit Polyclonal Antibody

The ARID5A Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to ARID5A. This antibody recognizes Homo Sapiens, and Human antigen. The ARID5A Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-ARID5A Antibody

Product Specs
ItemARID5A Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339849
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetARID5A
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-ARID5A antibody: synthetic peptide directed towards the N terminal of human ARID5A. Synthetic peptide located within the following region: LWKNVYDELGGSPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPTSKP
NCBI Full Gene NameAT-rich interaction domain 5A
NCBI Gene AliasesMRF-1, MRF1, RP11-363D14
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!