SPRING1 Rabbit Polyclonal Antibody TA338672 from OriGene Technologies | Biocompare.com

Supplier Images

SPRING1 Rabbit Polyclonal Antibody

WB Suggested Anti-C12orf49 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
SPRING1 Rabbit Polyclonal Antibody

The SPRING1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to SPRING1. This antibody recognizes Homo Sapiens, and Human antigen. The SPRING1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-C12orf49 Antibody

Product Specs
ItemSPRING1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338672
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
PurityProtein A purified
ReactivityHuman
TargetSPRING1
IsotypeIgG
HostRabbit
TypePrimary Antibodies
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C12orf49 antibody: synthetic peptide directed towards the C terminal of human C12orf49. Synthetic peptide located within the following region: LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY
NCBI Full Gene NameSREBF pathway regulator in golgi 1
ClonalityPolyclonal
NCBI Gene AliasesC12orf49, SPRING, LUR1, POST1

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!