CTDSPL Rabbit Polyclonal Antibody TA346421 from OriGene Technologies | Biocompare.com

Supplier Images

CTDSPL Rabbit Polyclonal Antibody

WB Suggested Anti-CTDSPL Antibody Titration: 0.2-1 ug/ml; Positive Control: DLD1 cell lysate; CTDSPL is strongly supported by BioGPS gene expression data to be expressed in Human DLD1 cells
CTDSPL Rabbit Polyclonal Antibody

Rabbit Anti-CTDSPL Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Be the first to write a review!

Supplier Page from
OriGene Technologies for
CTDSPL Rabbit Polyclonal Antibody

OriGene Technologies' CTDSPL Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-CTDSPL Antibody

Product Specs
ItemCTDSPL Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346421
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetCTDSPL
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL. Synthetic peptide located within the following region: CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
NCBI Full Gene NameCTD small phosphatase like
NCBI Gene AliasesC3orf8, HYA22, PSR1, SCP3, RBSP3
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!