CFAP410 Rabbit Polyclonal Antibody TA338922 from OriGene Technologies | Biocompare.com

Supplier Images

CFAP410 Rabbit Polyclonal Antibody

WB Suggested Anti-C21orf2 Antibody Titration: 5% Milk; ELISA Titer: dilution: 1: 500; Positive Control: human LCL
CFAP410 Rabbit Polyclonal Antibody

WB Suggested Anti-C21orf2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: 293T cell lysate.There is BioGPS gene expression data showing that C21orf2 is expressed in HEK293T

Be the first to write a review!

Supplier Page from
OriGene Technologies for
CFAP410 Rabbit Polyclonal Antibody

The CFAP410 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to CFAP410. This antibody recognizes Homo Sapiens, and Human antigen. The CFAP410 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-C21orf2 Antibody

Product Specs
ItemCFAP410 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338922
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetCFAP410
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C21orf2 antibody: synthetic peptide directed towards the N terminal of human C21orf2. Synthetic peptide located within the following region: KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS
NCBI Full Gene Namecilia and flagella associated protein 410
NCBI Gene AliasesRDMS, LRRC76, C21orf2, YF5/A2, SMDAX
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!