Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody TA339141 from OriGene Technologies | Biocompare.com

Supplier Images

Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody

WB Suggested Anti-RXRG Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody

OriGene Technologies' Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-RXRG Antibody

Product Specs
ItemRetinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA339141
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetRetinoid X Receptor gamma
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: GSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLP
NCBI Full Gene Nameretinoid X receptor gamma
NCBI Gene AliasesNR2B3, RXRgamma, RXR-gamma, RXRC
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!