OSTA (SLC51A) Rabbit Polyclonal Antibody TA338900 from OriGene Technologies

Product Specs
ItemOSTA (SLC51A) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338900
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetOSTA
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-OSTalpha antibody: synthetic peptide directed towards the middle region of human OSTalpha. Synthetic peptide located within the following region: LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
NCBI Full Gene Namesolute carrier family 51 subunit alpha
NCBI Gene AliasesPFIC6, OSTalpha, OSTA
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

(1) Bile acid profiles within the enterohepatic circulation in a diabetic rat model after bariatric surgeriesAmerican journal of physiology. Gastrointestinal and liver physiologyMay 1, 2018Wei M, Shao Y, Liu QR, Wu QZ, Zhang X, Zhong MW, Liu SZ, Zhang GY, Hu SY.

(2) Robotically handled whole-tissue culture system for the screening of oral drug formulationsNature biomedical engineeringJanuary 1, 0001"von Erlach T, Saxton S, Shi Y, Minahan D, Reker D, Javid F, Lee YL, Schoellhammer C, Esfandiary T, Cleveland C, et al."Lysozyme (Rabbit polyclonal, Abcam, Cat number ab2408), Ost-alpha (Rabbit polyclonal, Origene, Cat. number TA338900, Lot number QC26750), OLFM4 (Rabbit polyclonal, Abcam, Cat number ab188812), OCT-1 (Rabbit monoclonal

Be the First to Write a Review!

OSTA (SLC51A) Rabbit Polyclonal Antibody

OSTA (SLC51A) Rabbit Polyclonal Antibody from OriGene Technologies

Description

OriGene Technologies

Citations (2)

Reviews

OSTA (SLC51A) Rabbit Polyclonal Antibody from OriGene Technologies

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map