PCLAF Rabbit Polyclonal Antibody TA338977 from OriGene Technologies | Biocompare.com

Supplier Images

PCLAF Rabbit Polyclonal Antibody

WB Suggested Anti-KIAA0101 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate.KIAA0101 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Be the first to write a review!

Supplier Page from
OriGene Technologies for
PCLAF Rabbit Polyclonal Antibody

OriGene Technologies' PCLAF Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The PCLAF Rabbit Polyclonal Antibody was generated using PCLAF as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-KIAA0101 Antibody

Product Specs
ItemPCLAF Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338977
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetPCLAF
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-KIAA0101 antibody: synthetic peptide directed towards the N terminal of human KIAA0101. Synthetic peptide located within the following region: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKEHVLCNLI
NCBI Full Gene NamePCNA clamp associated factor
NCBI Gene AliasesNS5ATP9, p15PAF, p15/PAF, OEATC1, L5, p15(PAF), PAF, OEATC-1, KIAA0101, OEATC, PAF15
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!