RAD9 homolog B (RAD9B) Rabbit Polyclonal Antibody TA338849 from OriGene Technologies | Biocompare.com

Supplier Images

RAD9 homolog B (RAD9B) Rabbit Polyclonal Antibody

WB Suggested Anti-RAD9B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: THP-1 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RAD9 homolog B (RAD9B) Rabbit Polyclonal Antibody

The RAD9 homolog B (RAD9B) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RAD9B. This antibody recognizes Homo Sapiens, and Human antigen. The RAD9 homolog B (RAD9B) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-RAD9B Antibody

Product Specs
ItemRAD9 homolog B (RAD9B) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338849
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetRAD9 homolog B
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RAD9B antibody: synthetic peptide directed towards the middle region of human RAD9B. Synthetic peptide located within the following region: SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED
NCBI Full Gene NameRAD9 checkpoint clamp component B
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!