Wasf2 Rabbit Polyclonal Antibody TA339193 from OriGene Technologies | Biocompare.com

Supplier Images

Wasf2 Rabbit Polyclonal Antibody

WB Suggested Anti-Wasf2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse heart

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Wasf2 Rabbit Polyclonal Antibody

OriGene Technologies' Wasf2 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Wasf2 Rabbit Polyclonal Antibody was generated using WASP family, member 2 as the antigen and it reacts with Mouse.

Description

Rabbit Polyclonal Anti-Wasf2

Product Specs
ItemWasf2 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339193
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityMouse
TargetWasf2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Wasf2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRK
NCBI Full Gene NameWASP family, member 2
NCBI Gene AliasesWAVE2, D4Ertd13e
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!