Zfp69 Rabbit Polyclonal Antibody TA339833 from OriGene Technologies | Biocompare.com

Supplier Images

Zfp69 Rabbit Polyclonal Antibody

WB Suggested Anti-Zfp69 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Testis

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Zfp69 Rabbit Polyclonal Antibody

The Zfp69 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Mouse antigen. The Zfp69 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Zfp69 Antibody

Product Specs
ItemZfp69 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339833
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetZfp69
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Zfp69 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Zfp69. Synthetic peptide located within the following region: KAFRQRIHLSNHRTVHTGVKAYECNRCGKAYRHDSSFKKHQRHHTGEKPY
NCBI Full Gene Namezinc finger protein 69
NCBI Gene AliasesKrab2, Zfp63, Gm1029
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!