Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody TA346383 from OriGene Technologies | Biocompare.com

Supplier Images

Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody

AGTR1 antibody - N-terminal region validated by WB using Mouse Brain Membranes at 1: 4000.
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody

WB Suggested Anti-AGTR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human heart

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody

OriGene Technologies' Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody was generated using AGTR1 as the antigen and it reacts with Homo Sapiens, Human, and Mouse.

Description

Rabbit Polyclonal Anti-AGTR1 Antibody

Product Specs
ItemAngiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346383
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman, Mouse
TargetAngiotensin II Type 1 Receptor
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI
NCBI Full Gene Nameangiotensin II receptor type 1
NCBI Gene AliasesAT1AR, AT1R, AT1BR, AG2S, ATR1, AT2R1, HAT1R, AT1, AGTR1B, AT1B
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!