GLUR3 (GRIA3) Rabbit Polyclonal Antibody TA338509 from OriGene Technologies | Biocompare.com

Supplier Images

GLUR3 (GRIA3) Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: Gria3; Sample Tissue: Rat Stomach lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
GLUR3 (GRIA3) Rabbit Polyclonal Antibody

The GLUR3 (GRIA3) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Mouse, and Rat antigen. The GLUR3 (GRIA3) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Gria3 Antibody

Product Specs
ItemGLUR3 (GRIA3) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338509
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityMouse, Rat
TargetGLUR3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Gria3 antibody is: synthetic peptide directed towards the middle region of Rat Gria3. Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM
NCBI Full Gene Nameglutamate ionotropic receptor AMPA type subunit 3
NCBI Gene AliasesMRXSW, GluA3, GLUR-K3, GLUR3, MRX94, GLUR-C, iGluR3, GLURC
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!