DKK1 Rabbit Polyclonal Antibody TA346496 from OriGene Technologies | Biocompare.com

Supplier Images

DKK1 Rabbit Polyclonal Antibody

Lanes: Lane 1: 30ug human PLC/PRF5 cell lysate; Lane 2: 30ug DKK1 PLC/PRF5 cell lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 10, 000; Gene Name: DKK1
DKK1 Rabbit Polyclonal Antibody

WB Suggested Anti-DKK1 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
DKK1 Rabbit Polyclonal Antibody

The DKK1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to DKK1. This antibody recognizes Homo Sapiens, and Human antigen. The DKK1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-DKK1 Antibody

Product Specs
ItemDKK1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA346496
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetDKK1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD
NCBI Full Gene Namedickkopf WNT signaling pathway inhibitor 1
NCBI Gene AliasesSK, DKK-1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!