DYNC1I1 Rabbit Polyclonal Antibody TA340053 from OriGene Technologies | Biocompare.com

Supplier Images

DYNC1I1 Rabbit Polyclonal Antibody

WB Suggested Anti-DYNC1I1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human brain

Be the first to write a review!

Supplier Page from
OriGene Technologies for
DYNC1I1 Rabbit Polyclonal Antibody

The DYNC1I1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to DYNC1I1. This antibody recognizes Homo Sapiens, and Human antigen. The DYNC1I1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-DYNC1I1 Antibody

Product Specs
ItemDYNC1I1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA340053
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
PurityAffinity Purified
ReactivityHuman
TargetDYNC1I1
IsotypeIgG
HostRabbit
TypePrimary Antibodies
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DYNC1I1 antibody: synthetic peptide directed towards the N terminal of human DYNC1I1. Synthetic peptide located within the following region: GSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFL
NCBI Full Gene Namedynein cytoplasmic 1 intermediate chain 1
NCBI Gene AliasesDNCIC1, DNCI1
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!