NOLC1 Rabbit Polyclonal Antibody TA339273 from OriGene Technologies | Biocompare.com

Supplier Images

NOLC1 Rabbit Polyclonal Antibody

NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5 ug/ml.NOLC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
NOLC1 Rabbit Polyclonal Antibody

Human kidney
NOLC1 Rabbit Polyclonal Antibody

Immunohistochemistry with pFa fixed zebrafish kidney tissue at an antibody concentration of 0.004 using anti-NOLC1 antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
NOLC1 Rabbit Polyclonal Antibody

The NOLC1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, Human, and Zebrafish/Fish antigen. The NOLC1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-NOLC1 Antibody

Product Specs
ItemNOLC1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA339273
Quantity100 µl
ApplicationsIHC, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Zebrafish
TargetNOLC1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-NOLC1 antibody: synthetic peptide directed towards the C terminal of human NOLC1. Synthetic peptide located within the following region: DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ
NCBI Full Gene Namenucleolar and coiled-body phosphoprotein 1
NCBI Gene AliasesSrp40, NOPP130, P130, NOPP140, NS5ATP13
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!