C9orf127 (TMEM8B) Rabbit Polyclonal Antibody TA346270 from OriGene Technologies | Biocompare.com

Supplier Images

C9orf127 (TMEM8B) Rabbit Polyclonal Antibody

WB Suggested Anti-C9orf127 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C9orf127 (TMEM8B) Rabbit Polyclonal Antibody

OriGene Technologies' C9orf127 (TMEM8B) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-C9orf127 Antibody

Product Specs
ItemC9orf127 (TMEM8B) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346270
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
ReactivityHuman
TargetC9orf127
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
TypePrimary Antibodies
ImmunogenThe immunogen for anti-C9orf127 antibody: synthetic peptide directed towards the C terminal of human C9orf127. Synthetic peptide located within the following region: CYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS
NCBI Full Gene Nametransmembrane protein 8B
NCBI Gene AliasesNAG5, NGX6a, LINC00950, NAG-5, NGX6, C9orf127, FP588
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!