ApoER2 Rabbit Antibody TA335245 from OriGene Technologies | Biocompare.com

Supplier Images

ApoER2 Rabbit Antibody

WB Suggested Anti-Lrp8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Liver

Be the first to write a review!

Supplier Page from
OriGene Technologies for
ApoER2 Rabbit Antibody

Description

Rabbit Polyclonal Anti-Lrp8 Antibody

Product Specs
ItemApoER2 Rabbit Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA335245
Quantity100 µl
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetApoER2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Lrp8 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRKMLIFSTDFLSHPFGVAVFEDKVFWTDLENEAIFSANRLNGLEIAILA
NCBI Full Gene NameLDL receptor related protein 8
NCBI Gene AliasesAPOER2, MCI1, LRP-8, HSZ75190
TypePrimary Antibodies
FormatShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!