Katna1 Rabbit Polyclonal Antibody TA340148 from OriGene Technologies | Biocompare.com

Supplier Images

Katna1 Rabbit Polyclonal Antibody

WB Suggested Anti-Katna1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Spleen

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Katna1 Rabbit Polyclonal Antibody

OriGene Technologies' Katna1 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-Katna1 Antibody

Product Specs
ItemKatna1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA340148
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetKatna1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Katna1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLR
NCBI Full Gene Namekatanin p60 (ATPase-containing) subunit A1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!