KCTD7 Rabbit Polyclonal Antibody TA338738 from OriGene Technologies | Biocompare.com

Supplier Images

KCTD7 Rabbit Polyclonal Antibody

WB Suggested Anti-KCTD7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Transfected 293T
KCTD7 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: KCTD7; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml
KCTD7 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: KCTD7; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml
KCTD7 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: KCTD7; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
KCTD7 Rabbit Polyclonal Antibody

The KCTD7 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen. The KCTD7 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-KCTD7 Antibody

Product Specs
ItemKCTD7 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338738
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetKCTD7
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-KCTD7 antibody: synthetic peptide directed towards the N terminal of human KCTD7. Synthetic peptide located within the following region: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE
NCBI Full Gene Namepotassium channel tetramerization domain containing 7
NCBI Gene AliasesCLN14, EPM3
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!