SENP6 Rabbit Polyclonal Antibody TA339719 from OriGene Technologies | Biocompare.com

Supplier Images

SENP6 Rabbit Polyclonal Antibody

Sample Type: 1.Rat Testis cells (200ug); Primary Dilution: 1: 1000; Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit; Secondary Dilution: 1: 1000; Image Submitted by: Andreia Carvalho; IBMC-OBF, Portugal See Customer Feedback tab for detail
SENP6 Rabbit Polyclonal Antibody

WB Suggested Anti-SENP6 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate SENP6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Be the first to write a review!

Supplier Page from
OriGene Technologies for
SENP6 Rabbit Polyclonal Antibody

OriGene Technologies' SENP6 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The SENP6 Rabbit Polyclonal Antibody was generated using SENP6 as the antigen and it reacts with Homo Sapiens, Human, and Rat.

Description

Rabbit Polyclonal Anti-SENP6 Antibody

Product Specs
ItemSENP6 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339719
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman, Rat
TargetSENP6
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-SENP6 antibody: synthetic peptide directed towards the C terminal of human SENP6. Synthetic peptide located within the following region: MNLANWFPPPRMRTKREEIRNIILKLQEDQSKEKRKHKDTYSTEAPLGEG
NCBI Full Gene NameSUMO specific peptidase 6
NCBI Gene AliasesSUSP1, SSP1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!