Fbx15 (FBXO15) Rabbit Polyclonal Antibody TA338901 from OriGene Technologies | Biocompare.com

Supplier Images

Fbx15 (FBXO15) Rabbit Polyclonal Antibody

WB Suggested Anti-FBXO15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: OVCAR-3 cell lysate
Fbx15 (FBXO15) Rabbit Polyclonal Antibody

FBXO15 antibody - N-terminal region validated by WB using 293T cells lysate at 1: 500.

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Fbx15 (FBXO15) Rabbit Polyclonal Antibody

OriGene Technologies' Fbx15 (FBXO15) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Fbx15 (FBXO15) Rabbit Polyclonal Antibody was generated using F-Box Protein 15 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-FBXO15 Antibody

Product Specs
ItemFbx15 (FBXO15) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338901
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetFbx15
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-FBXO15 antibody: synthetic peptide directed towards the N terminal of human FBXO15. Synthetic peptide located within the following region: QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL
NCBI Full Gene NameF-box protein 15
NCBI Gene AliasesFBX15
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!