KCNG1 Rabbit Polyclonal Antibody TA338758 from OriGene Technologies | Biocompare.com

Supplier Images

KCNG1 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNG1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: MCF7 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
KCNG1 Rabbit Polyclonal Antibody

OriGene Technologies' KCNG1 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The KCNG1 Rabbit Polyclonal Antibody was generated using KCNG1 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-KCNG1 Antibody

Product Specs
ItemKCNG1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338758
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetKCNG1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-KCNG1 antibody: synthetic peptide directed towards the N terminal of human KCNG1. Synthetic peptide located within the following region: YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA
NCBI Full Gene Namepotassium voltage-gated channel modifier subfamily G member 1
NCBI Gene AliasesK13, KV6.1, kH2, KCNG
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!