PPPDE1 (DESI2) Rabbit Polyclonal Antibody TA346132 from OriGene Technologies | Biocompare.com

Supplier Images

PPPDE1 (DESI2) Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: DESI2; Sample Tissue: PANC1 Whole cell lysates; Antibody Dilution: 1.0 ug/ml; DESI2 is strongly supported by BioGPS gene expression data to be expressed in Human PANC1 cells

Be the first to write a review!

Supplier Page from
OriGene Technologies for
PPPDE1 (DESI2) Rabbit Polyclonal Antibody

The PPPDE1 (DESI2) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to DESI2. This antibody recognizes Homo Sapiens, and Human antigen. The PPPDE1 (DESI2) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-DESI2 Antibody

Product Specs
ItemPPPDE1 (DESI2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346132
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetPPPDE1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-DESI2 antibody is: synthetic peptide directed towards the C-terminal region of Human DESI2. Synthetic peptide located within the following region: SCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHT
NCBI Full Gene Namedesumoylating isopeptidase 2
NCBI Gene AliasesC1orf121, FAM152A, DESI1, DeSI-2, PNAS-4, DESI, CGI-146, PPPDE1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!