SWAP70 Rabbit Polyclonal Antibody TA339321 from OriGene Technologies | Biocompare.com

Supplier Images

SWAP70 Rabbit Polyclonal Antibody

WB Suggested Anti-SWAP70 Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
SWAP70 Rabbit Polyclonal Antibody

The SWAP70 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to SWAP70. This antibody recognizes Homo Sapiens, and Human antigen. The SWAP70 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-SWAP70 Antibody

Product Specs
ItemSWAP70 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA339321
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
PurityProtein A purified
ReactivityHuman
TargetSWAP70
IsotypeIgG
HostRabbit
TypePrimary Antibodies
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-SWAP70 antibody: synthetic peptide directed towards the N terminal of human SWAP70. Synthetic peptide located within the following region: ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK
NCBI Full Gene Nameswitching B cell complex subunit SWAP70
NCBI Gene AliasesSWAP-70, HSPC321
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!