FADS1 Rabbit Polyclonal Antibody TA346475 from OriGene Technologies | Biocompare.com

Supplier Images

FADS1 Rabbit Polyclonal Antibody

WB Suggested Anti-FADS1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate; FADS1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FADS1 Rabbit Polyclonal Antibody

OriGene Technologies' FADS1 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-FADS1 Antibody

Product Specs
ItemFADS1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346475
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetFADS1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-FADS1 antibody: synthetic peptide directed towards the N terminal of human FADS1. Synthetic peptide located within the following region: RHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSF
NCBI Full Gene Namefatty acid desaturase 1
NCBI Gene AliasesTU12, FADSD5, D5D, LLCDL1, FADS6
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!