SDF2 Rabbit Polyclonal Antibody TA346757 from OriGene Technologies | Biocompare.com

Supplier Images

SDF2 Rabbit Polyclonal Antibody

WB Suggested Anti-SDF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate.SDF2 is supported by BioGPS gene expression data to be expressed in HepG2
SDF2 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: SDF2; Sample Tissue: Human MCF7; Antibody Dilution: 1.0 ug/ml.SDF2 is supported by BioGPS gene expression data to be expressed in MCF7

Be the first to write a review!

Supplier Page from
OriGene Technologies for
SDF2 Rabbit Polyclonal Antibody

OriGene Technologies' SDF2 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The SDF2 Rabbit Polyclonal Antibody was generated using SDF2 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-SDF2 Antibody

Product Specs
ItemSDF2 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346757
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetSDF2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-SDF2 antibody: synthetic peptide directed towards the middle region of human SDF2. Synthetic peptide located within the following region: RDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEG
NCBI Full Gene Namestromal cell derived factor 2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!