beta TRCP2 (FBXW11) Rabbit Polyclonal Antibody TA329828 from OriGene Technologies | Biocompare.com

Supplier Images

beta TRCP2 (FBXW11) Rabbit Polyclonal Antibody

WB Suggested Anti-FBXW11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateFBXW11 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Be the first to write a review!

Supplier Page from
OriGene Technologies for
beta TRCP2 (FBXW11) Rabbit Polyclonal Antibody

OriGene Technologies' beta TRCP2 (FBXW11) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody.

Description

Rabbit Polyclonal Anti-FBXW11 Antibody

Product Specs
Itembeta TRCP2 (FBXW11) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA329828
Quantity100 µl
Conjugate/TagUnconjugated
ReactivityHuman
Targetbeta TRCP2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-FBXW11 antibody: synthetic peptide directed towards the N terminal of human FBXW11. Synthetic peptide located within the following region: CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD
NCBI Full Gene NameF-box and WD repeat domain containing 11
NCBI Gene AliasesNEDJED, BTRCP2, FBW1B, FBXW1B, Hos, Fbw11, BTRC2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!