KCNK15 Rabbit Polyclonal Antibody TA338709 from OriGene Technologies | Biocompare.com

Supplier Images

KCNK15 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNK15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

Be the first to write a review!

Supplier Page from
OriGene Technologies for
KCNK15 Rabbit Polyclonal Antibody

The KCNK15 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to KCNK15. This antibody recognizes Homo Sapiens, and Human antigen. The KCNK15 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-KCNK15 Antibody

Product Specs
ItemKCNK15 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338709
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetKCNK15
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-KCNK15 antibody: synthetic peptide directed towards the middle region of human KCNK15. Synthetic peptide located within the following region: ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI
NCBI Full Gene Namepotassium two pore domain channel subfamily K member 15
NCBI Gene AliasesTASK-5, TASK5, KT3.3, KCNK14, KCNK11, dJ781B1.1, K2p15.1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!