Carboxypeptidase N subunit 2 (CPN2) Rabbit Polyclonal Antibody TA339984 from OriGene Technologies | Biocompare.com

Supplier Images

Carboxypeptidase N subunit 2 (CPN2) Rabbit Polyclonal Antibody

1Hum. Adult Placenta; Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml
Carboxypeptidase N subunit 2 (CPN2) Rabbit Polyclonal Antibody

WB Suggested Anti-CPN2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate CPN2 is supported by BioGPS gene expression data to be expressed in HepG2

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Carboxypeptidase N subunit 2 (CPN2) Rabbit Polyclonal Antibody

OriGene Technologies' Carboxypeptidase N subunit 2 (CPN2) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-CPN2 Antibody

Product Specs
ItemCarboxypeptidase N subunit 2 (CPN2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339984
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetCarboxypeptidase N subunit 2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-CPN2 antibody: synthetic peptide directed towards the N terminal of human CPN2. Synthetic peptide located within the following region: FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL
NCBI Full Gene Namecarboxypeptidase N subunit 2
NCBI Gene AliasesACBP
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!