NARG1L (NAA16) Rabbit Polyclonal Antibody TA346823 from OriGene Technologies | Biocompare.com

Supplier Images

NARG1L (NAA16) Rabbit Polyclonal Antibody

WB Suggested Anti-NARG1L Antibody Titration: 1 ug/ml; Positive Control: HepG2 cell lysateNAA16 is supported by BioGPS gene expression data to be expressed in HepG2
NARG1L (NAA16) Rabbit Polyclonal Antibody

Human Muscle

Be the first to write a review!

Supplier Page from
OriGene Technologies for
NARG1L (NAA16) Rabbit Polyclonal Antibody

The NARG1L (NAA16) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to N-alpha-acetyltransferase 16, NatA auxiliary subunit, and NAA16. This antibody recognizes Homo Sapiens, and Human antigen. The NARG1L (NAA16) Rabbit Polyclonal Antibody has been shown to work in the following applications: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-NARG1L Antibody

Product Specs
ItemNARG1L (NAA16) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346823
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetNARG1L
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-NARG1L antibody: synthetic peptide directed towards the middle region of human NARG1L. Synthetic peptide located within the following region: ASLKTCDFFSPYENGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAA
NCBI Full Gene NameN-alpha-acetyltransferase 16, NatA auxiliary subunit
NCBI Gene AliasesNARG1L
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!