ZNF167 (ZKSCAN7) Rabbit Polyclonal Antibody TA339510 from OriGene Technologies | Biocompare.com

Supplier Images

ZNF167 (ZKSCAN7) Rabbit Polyclonal Antibody

WB Suggested Anti-ZNF167 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate
ZNF167 (ZKSCAN7) Rabbit Polyclonal Antibody

Human Intestine

Be the first to write a review!

Supplier Page from
OriGene Technologies for
ZNF167 (ZKSCAN7) Rabbit Polyclonal Antibody

The ZNF167 (ZKSCAN7) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen. The ZNF167 (ZKSCAN7) Rabbit Polyclonal Antibody has been shown to work in the following applications: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-ZNF167 Antibody

Product Specs
ItemZNF167 (ZKSCAN7) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA339510
Quantity100 µl
ApplicationsIHC, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetZNF167
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-ZNF167 antibody: synthetic peptide directed towards the N terminal of human ZNF167. Synthetic peptide located within the following region: LGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFR
NCBI Full Gene Namezinc finger with KRAB and SCAN domains 7
NCBI Gene AliasesZNF167, ZFP, ZNF448, ZNF64, ZSCAN39
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!