FAM164B (ZC2HC1B) Rabbit Polyclonal Antibody TA339862 from OriGene Technologies | Biocompare.com

Supplier Images

FAM164B (ZC2HC1B) Rabbit Polyclonal Antibody

WB Suggested Anti-ZC2HC1B Antibody Titration: 0.125 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FAM164B (ZC2HC1B) Rabbit Polyclonal Antibody

The FAM164B (ZC2HC1B) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen. The FAM164B (ZC2HC1B) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-ZC2HC1B Antibody

Product Specs
ItemFAM164B (ZC2HC1B) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339862
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetFAM164B
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C6orf94 antibody: synthetic peptide directed towards the N terminal of human C6orf94. Synthetic peptide located within the following region: PICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSKSPPVRKSNWRQQHE
NCBI Full Gene Namezinc finger C2HC-type containing 1B
NCBI Gene AliasesFAM164B, dJ468K18.5, C6orf94
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!