SIGLEC6 Rabbit Polyclonal Antibody TA346279 from OriGene Technologies | Biocompare.com

Supplier Images

SIGLEC6 Rabbit Polyclonal Antibody

WB Suggested Anti-SIGLEC6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Jurkat cell lysate
SIGLEC6 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: SIGLEC6; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
SIGLEC6 Rabbit Polyclonal Antibody

The SIGLEC6 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen. The SIGLEC6 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-SIGLEC6 Antibody

Product Specs
ItemSIGLEC6 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346279
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetSIGLEC6
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the N terminal of human SIGLEC6. Synthetic peptide located within the following region: VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL
NCBI Full Gene Namesialic acid binding Ig like lectin 6
NCBI Gene AliasesCDW327, OBBP1, CD33L, CD33L1, CD33L2, CD327
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!