DHODH Rabbit Polyclonal Antibody TA346290 from OriGene Technologies | Biocompare.com

Supplier Images

DHODH Rabbit Polyclonal Antibody

WB Suggested Anti-DHODH Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate.DHODH is supported by BioGPS gene expression data to be expressed in Jurkat

Be the first to write a review!

Supplier Page from
OriGene Technologies for
DHODH Rabbit Polyclonal Antibody

The DHODH Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen. The DHODH Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-DHODH Antibody

Product Specs
ItemDHODH Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346290
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetDHODH
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DHODH antibody: synthetic peptide directed towards the C terminal of human DHODH. Synthetic peptide located within the following region: GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS
NCBI Full Gene Namedihydroorotate dehydrogenase (quinone)
NCBI Gene AliasesDHOdehase, POADS, URA1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!