C3orf26 Rabbit Antibody TA332162 from OriGene Technologies | Biocompare.com

Supplier Images

C3orf26 Rabbit Antibody

Host: Rabbit
Target Name: C3orf26
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C3orf26 Rabbit Antibody

Description

Rabbit Polyclonal Anti-CMSS1 Antibody

Product Specs
ItemC3orf26 Rabbit Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA332162
Quantity100 µl
Conjugate/TagUnconjugated
ReactivityHuman
TargetC3orf26
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-C3orf26 Antibody is: synthetic peptide directed towards the N-terminal region of Human C3orf26. Synthetic peptide located within the following region: EASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTR
NCBI Full Gene Namecms1 ribosomal small subunit homolog
NCBI Gene AliasesC3orf26
TypePrimary Antibodies
FormatShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!