HSD17B6 Rabbit Polyclonal Antibody TA346101 from OriGene Technologies | Biocompare.com

Supplier Images

HSD17B6 Rabbit Polyclonal Antibody

WB Suggested Anti-HSD17B6 Antibody Titration: 1.25 ug/ml; Positive Control: A172 cell lysateHSD17B6 is strongly supported by BioGPS gene expression data to be expressed in Human A172 cells
HSD17B6 Rabbit Polyclonal Antibody

Rabbit Anti-HSD17B6 Antibody; Paraffin Embedded Tissue: Human Liver; Cellular Data: Hemopoietic; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Be the first to write a review!

Supplier Page from
OriGene Technologies for
HSD17B6 Rabbit Polyclonal Antibody

OriGene Technologies' HSD17B6 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-HSD17B6 Antibody

Product Specs
ItemHSD17B6 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA346101
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetHSD17B6
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-HSD17B6 antibody: synthetic peptide directed towards the N terminal of human HSD17B6. Synthetic peptide located within the following region: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD
NCBI Full Gene Namehydroxysteroid 17-beta dehydrogenase 6
NCBI Gene AliasesRODH, SDR9C6, HSE
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!