Nav1.6 (SCN8A) Rabbit Polyclonal Antibody TA338572 from OriGene Technologies | Biocompare.com

Supplier Images

Nav1.6 (SCN8A) Rabbit Polyclonal Antibody

WB Suggested Anti-SCN8A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Muscle
Nav1.6 (SCN8A) Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: SCN8A; Sample Tissue: NCI-H226; Antibody Dilution: 1.0 ug/ml SCN8A is supported by BioGPS gene expression data to be expressed in NCIH226

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Nav1.6 (SCN8A) Rabbit Polyclonal Antibody

OriGene Technologies' Nav1.6 (SCN8A) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-SCN8A Antibody

Product Specs
ItemNav1.6 (SCN8A) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338572
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetNav1.6
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-SCN8A antibody: synthetic peptide directed towards the middle region of human SCN8A. Synthetic peptide located within the following region: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC
NCBI Full Gene Namesodium voltage-gated channel alpha subunit 8
NCBI Gene AliasesMED, Nav1.6, EIEE13, BFIS5, DEE13, PN4, CIAT, CERIII, NaCh6, MYOCL2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!