NDUFV1 Rabbit Polyclonal Antibody TA346612 from OriGene Technologies | Biocompare.com

Supplier Images

NDUFV1 Rabbit Polyclonal Antibody

NDUFV1 Antibody in Human Liver cells using Western blot
NDUFV1 Rabbit Polyclonal Antibody

NDUFV1 Antibody in Human Lung cells using Western blot

Be the first to write a review!

Supplier Page from
OriGene Technologies for
NDUFV1 Rabbit Polyclonal Antibody

OriGene Technologies' NDUFV1 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-NDUFV1 Antibody

Product Specs
ItemNDUFV1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $515.00Supplier Page View Company Product Page
Catalog NumberTA346612
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetNDUFV1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-NDUFV1 antibody: synthetic peptide directed towards the N terminal of human NDUFV1. Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG
NCBI Full Gene NameNADH:ubiquinone oxidoreductase core subunit V1
NCBI Gene AliasesCI-51K, CI51KD, UQOR1, MC1DN4
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!