ZBTB46 Rabbit Polyclonal Antibody TA339759 from OriGene Technologies | Biocompare.com

Supplier Images

ZBTB46 Rabbit Polyclonal Antibody

WB Suggested Anti-ZBTB46 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Placenta

Be the first to write a review!

Supplier Page from
OriGene Technologies for
ZBTB46 Rabbit Polyclonal Antibody

OriGene Technologies' ZBTB46 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-ZBTB46 Antibody

Product Specs
ItemZBTB46 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339759
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetZBTB46
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-ZBTB46 antibody: synthetic peptide directed towards the N terminal of human ZBTB46. Synthetic peptide located within the following region: MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDVCVVVEGKVFKAHKNVLL
NCBI Full Gene Namezinc finger and BTB domain containing 46
NCBI Gene AliasesdJ583P15.8, RINZF, dJ583P15.7, ZNF340, BTBD4, BZEL
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!