SUN1 Rabbit Polyclonal Antibody TA339546 from OriGene Technologies | Biocompare.com

Supplier Images

SUN1 Rabbit Polyclonal Antibody

WB Suggested Anti-SUN1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate
SUN1 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: SUN1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml
SUN1 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: SUN1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
SUN1 Rabbit Polyclonal Antibody

The SUN1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to SUN1. This antibody recognizes Homo Sapiens, Human, and Mouse antigen. The SUN1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-SUN1 Antibody

Product Specs
ItemSUN1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339546
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Mouse
TargetSUN1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-UNC84A antibody: synthetic peptide directed towards the N terminal of human UNC84A. Synthetic peptide located within the following region: QDAVTRRPPVLDESWIREQTTVDHFWGLDDDGDLKGGNKAAIQGNGDVGA
NCBI Full Gene NameSad1 and UNC84 domain containing 1
NCBI Gene AliasesUNC84A
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!