RNF182 Rabbit Polyclonal Antibody TA330520 from OriGene Technologies | Biocompare.com

Supplier Images

RNF182 Rabbit Polyclonal Antibody

WB Suggested Anti-RNF182 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RNF182 Rabbit Polyclonal Antibody

The RNF182 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen.

Description

Rabbit Polyclonal Anti-RNF182 Antibody

Product Specs
ItemRNF182 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA330520
Quantity100 µl
Conjugate/TagUnconjugated
ReactivityHuman
TargetRNF182
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RNF182 antibody: synthetic peptide directed towards the middle region of human RNF182. Synthetic peptide located within the following region: LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY
NCBI Full Gene Namering finger protein 182
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!