CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody TA342812 from OriGene Technologies | Biocompare.com

Supplier Images

CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody

WB Suggested Anti-CNTFR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody

A549, H441

Be the first to write a review!

Supplier Page from
OriGene Technologies for
CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody

OriGene Technologies' CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. The CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody was generated using CNTFR as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-CNTFR Antibody

Product Specs
ItemCNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA342812
Quantity100 µl
Conjugate/TagUnconjugated
ReactivityHuman
TargetCNTF Receptor alpha
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-CNTFR antibody: synthetic peptide directed towards the C terminal of human CNTFR. Synthetic peptide located within the following region: VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG
NCBI Full Gene Nameciliary neurotrophic factor receptor
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!