HTR3B Rabbit Polyclonal Antibody TA338559 from OriGene Technologies | Biocompare.com

Supplier Images

HTR3B Rabbit Polyclonal Antibody

WB Suggested Anti-HTR3B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate
HTR3B Rabbit Polyclonal Antibody

Rabbit Anti-HTR3B Antibody; Paraffin Embedded Tissue: Human Spleen; Cellular Data: Spleen cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X
HTR3B Rabbit Polyclonal Antibody

Sample Type : Spinal Cord, ventral horns;

Be the first to write a review!

Supplier Page from
OriGene Technologies for
HTR3B Rabbit Polyclonal Antibody

OriGene Technologies' HTR3B Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunocytochemistry, Immunofluorescence, Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-HTR3B Antibody

Product Specs
ItemHTR3B Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $575.00Supplier Page View Company Product Page
Catalog NumberTA338559
Quantity100 µl
ApplicationsIF, IHC, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Mouse
TargetHTR3B
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT
NCBI Full Gene Name5-hydroxytryptamine receptor 3B
NCBI Gene Aliases5-HT3B
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!