Rapgef2 Rabbit Polyclonal Antibody TA329532 from OriGene Technologies | Biocompare.com

Supplier Images

Rapgef2 Rabbit Polyclonal Antibody

WB Suggested Anti-Rapgef2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney
Rapgef2 Rabbit Polyclonal Antibody

Human sperm and mouse liver

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rapgef2 Rabbit Polyclonal Antibody

OriGene Technologies' Rapgef2 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody.

Description

Rabbit Polyclonal anti-Rapgef2 antibody

Product Specs
ItemRapgef2 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $575.00Supplier Page View Company Product Page
Catalog NumberTA329532
Quantity100 µl
Conjugate/TagUnconjugated
ReactivityHuman, Mouse
TargetRapgef2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Rapgef2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SILPQKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQS
NCBI Full Gene NameRap guanine nucleotide exchange factor (GEF) 2
NCBI Gene AliasesmKIAA0313, RA-GEF-1, Pdzgef1, nRapGEP, 5830453M24Rik, CNRasGEF
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!