Pokemon (ZBTB7A) Rabbit Polyclonal Antibody TA339480 from OriGene Technologies | Biocompare.com

Supplier Images

Pokemon (ZBTB7A) Rabbit Polyclonal Antibody

WB Suggested Anti-ZBTB7A Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Pokemon (ZBTB7A) Rabbit Polyclonal Antibody

The Pokemon (ZBTB7A) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to Zbtb7a. This antibody recognizes Homo Sapiens, and Human antigen. The Pokemon (ZBTB7A) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-ZBTB7A Antibody

Product Specs
ItemPokemon (ZBTB7A) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA339480
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetPokemon
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-ZBTB7A antibody: synthetic peptide directed towards the middle region of human ZBTB7A. Synthetic peptide located within the following region: PPAERPPTGDGDEGDSNPGLWPERDEDAPTGGLFPPPVAPPAATQNGHYG
NCBI Full Gene Namezinc finger and BTB domain containing 7A
NCBI Gene AliasesZNF857A, FBI-1, LRF, TIP21, MNDLFH, ZBTB7, pokemon, FBI1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!